Проблема с неон бумажник

Я обновил и теперь работает 4.4.2, и был удивлен обновления:

  • Клавиши со стрелками у меня теперь не существуют. Я нуждаюсь в них.
  • Также, когда он получает слово неправильное, я не могу вернуть-удалить символы, он просто удаляет слово целиком.

Есть ли выход из этого?

+445
Kykyryza 28 нояб. 2011 г., 17:36:45
20 ответов

Вы можете сделать это, просто перетаскивая нужные пикселя в левом верхнем углу экрана. Это позволит создать прямоугольник выделения, и размер этого прямоугольника отображается на экране. Поскольку прямоугольник может только растянуть, пока не достигнет исходной точки (угол), его размер будет таким же, как пиксельные координаты, которые вы ищете.

+965
M S Kishore 03 февр. '09 в 4:24

Шариата в Ачехе довольно стандартно, если строгие вещи:

  • Никакого алкоголя или азартных игр.
  • Нет khalwat ("близость") не связанных между собой, без сопровождения мужчины и женщины. Это распространяется не только на очевидное (например. обмен номер в гостинице), но даже обедать вместе в ресторанах и т. д.
    • Что сказал, незамужняя западных пара может просто требовать , чтобы быть женатым, и они, скорее всего, будет просто замечательно.
  • Консервативное платье для женщин: платок требуется, никаких голых рук, без открытого декольте, ни узкие брюки/леггинсы или бикини на пляже.
  • Магазины и рестораны закрываются во время молитвы пять раз в день.
  • Пятница является праздником, многие магазины закрыты либо полностью, либо во время/до полуденной молитвы. Спорт, Плавание и т. д. Здесь вообще не уместен.

Существует некоторая путаница по поводу того, шариат даже распространяется на немусульман. По закону, ответ "да", но на практике не очень — я, конечно, не в курсе любой посетитель наказывают по законам шариата. Органов также зависит от региона, туристический биты как пляжи Сабанг (вех) не беспокоило и даже алкоголь широко доступен (если дороже, чем обычно).

+758
Thiago Conrado 17 дек. 2022 г., 22:15:07
Другие ответы

Связанные вопросы


Похожие вопросы

С ванильным установка Убунту 12.04 на ванили установку виртуальной коробка с NAT на VB, Мои настройки сети, кажется, неправильно.

Что озадачивает меня в том, что я могу пинг www.google.comно я не могу с wget www.google.com.

пинг www.google.com
Пинг www.l.google.com (74.125.226.17) 56(84) байт данных.
64 байт из yyz06s05-in-f17.1e100.net (74.125.226.17): icmp_req=1 ttl с=49 время=28.3 МС

и

с wget http://www.google.com
--2012-05-08 12:09:32-- http://www.google.com/
Решение www.google.com (www.google.com)... 74.125.228.48, 74.125.228.49, 74.125.228.50, ...
Подключение к www.google.com (www.google.com)|74.125.228.48|:80... ошибка: превышено время ожидания подключения.

Я в корпоративной сети, так что могут возникнуть проблемы брандмауэра или другие параметры безопасности, которые мне неизвестны. Но мне кажется странным, что я должен быть в состоянии пинговать, а не HTTP-доступ, так как я могу сделать как на хост системе (Windows).

Среди других вопросов:

  • я должен присвоить один и тот же MAC-адрес в этот виртуальный интерфейс, как фактический MAC-адрес интерфейса СЗ хозяина? Это хорошая или плохая практика?

Редактировать:

$ команда nslookup google.com 
Сервер: 127.0.0.1
Адрес: 127.0.0.1#53

Не заслуживающий доверия ответ:
Имя: google.com
Адрес: 74.125.226.72
Имя: google.com
Адрес: 74.125.226.68
Имя: google.com
Адрес: 74.125.226.71
Имя: google.com
Адрес: 74.125.226.69
Имя: google.com
Адрес: 74.125.226.70
Имя: google.com
Адрес: 74.125.226.66
Имя: google.com
Адрес: 74.125.226.67
Имя: google.com
Адрес: 74.125.226.64
Имя: google.com
Адрес: 74.125.226.73
Имя: google.com
Адрес: 74.125.226.65
Имя: google.com
Адрес: 74.125.226.78

Правка 2:

Возможно, что мой установочный файл VBOX может быть неполной? Я не имею прав администратора на хост-системе. Установка, кажется, прошло хорошо (я могу установить и запустить виртуальную машину), но каждый раз, когда я загрузиться пытается установить то, что я не могу определить (в стиле Windows) и требуется доступ с правами администратора, которых у меня нет. Это может потенциально быть причиной моей проблемы с сетью?

Обратите внимание, что когда я открываю список сетевых связях, она включает в VirtualBox хост-адаптер только - так некоторые установки, но, возможно, не все, что требуется.

+758
Ravish Kumar 23 июл. 2017 г., 13:29:53

По умолчанию программа чтения PDF в 11.10, это проявить, чтобы установить его, просто нажав сочетание клавиш Ctrl+АЛТ+т на клавиатуре, чтобы открыть терминал. Когда она открывается, выполните команду ниже.

судо apt-получить установку выказывают
+691
oussama 6 окт. 2013 г., 08:57:25

Я не думаю, что целью является разрешение какой-либо расшифровки SD-карты без использования телефона был зашифрован. Или вы могли бы просто добавить определенные файлы в облаке, так что вам не придется беспокоиться о извлекаемый ситуациях, в большинстве случаев, люди склонны использовать "облако" для фотографий и видео, особенно с места она проглотит, имея 16 ГБ 60 Гб ценных файлов на SD-карте-это довольно рискованно против сохранения в облаке, но для ответа на ваш вопрос нужно найти его шифрование непосредственно служит цели недопущения расшифровки, если содержимое расшифровки от местечковых устройства

+587
ExpatEgghead 27 июл. 2016 г., 16:47:05

Это вполне приемлемо, чтобы попросить информацию. Его отсутствие реакции может быть вызвано несколько вещей. Один (скорее всего), что он просто занят и это имеет низкий приоритет для него. Другой, конечно, заключается в том, что он чувствует, что вы должны быть в состоянии найти ответы самостоятельно, исходя из формулировки вопроса, Вы спросили.

Если это было меньше, чем пару недель, я думаю, вы все равно можете ожидать ответа. Вы можете всегда следить, конечно, но не слишком скоро.

Вы также можете получить ответ, нужно из ничего опубликовано в мастерская. Это может быть хорошо, чтобы начать в любом случае.

И, кстати, пост-док-это, вероятно, посмеиваясь немного, чтобы считаться "старшим" человека. Они чувствуют себя довольно далеко вниз по иерархии, на самом деле. Но даже профессоров может быть задан, и ответ.

+556
user265234 30 дек. 2013 г., 09:43:21

Это, безусловно, рассматривается как сложный вопрос для буддистов. Я слышал, как он назвал Гленна Ходдла вопрос после того, как экс-футболист использовал карму тип аргументов, чтобы объяснить инвалидности - цитировать

Вы и я были физически даны две руки и две ноги и половина-приличные мозги. Некоторые люди не рождены для причина. Карма работает из другой жизни

Он был уволен с поста тренера сборной Англии. Однако это сложный вопрос и я постараюсь достойный ответ

Карма-это не причина и следствие

Карма-это не просто причина и следствие - это не. Цитировать Сивака сутра

Теперь, когда эти аскеты и отшельники имеют такой доктрины и воззрения что любой человек испытывает, будь то радость, боль или ни боли, ни удовольствия, все это обусловлено предыдущим действием,' затем они идут дальше, чем они знают сами и что принято как истинный мир. Поэтому я говорю, что это неправильно со стороны эти аскеты и отшельники.

Это не так, если кто-то лежит в одной жизни, то возродится как инвалид в следующем. Иногда плоды кармы (действия) являются непосредственными, иногда они задерживаются, иногда плоды не исполняется вообще.

Там больше происходит, чем карма

Также в буддизме есть понятие Niyamas, которая объясняет исход зависимое возникновение (в основе реальности). Это

  1. Камма Нияма: ("действие") последствия своих действий
  2. УТУ Нияма: ("время сезона") сезонные изменения и климат, закон неживой материи
  3. БиДжей Нияма: ("семя") законы наследственности
  4. Читта Нияма:("ум") будет ума
  5. Дхамма Нияма: тенденция (закон) природы до совершенства

Приведенный выше список взят из здесь. Так что карма будет объяснить только часть чьего-то условиях.

Карма не виноват

Я думаю, другая вещь, чтобы отметить, что нет понятия виноват во всем этом. В аудио здесь очень интересно - буддийская монахиня обсуждает этот точный проблема с кем-то со зрением трудности.

Даже если кто-то печальных обстоятельствах были причинены непосредственно в результате их действий (что означает не так просто), то это не могло бы остановить нас чувство сострадания к ним. Это было бы справедливо в этой жизни или в следующей. Если кого-то сбили потому, что они не смотрят в обе стороны, прежде чем перейти дорогу, то это нормальная реакция человека, испытываю к ним сострадание - буддийской или нет.

Как я говорю, хотя и трудный и интересный вопрос. Я надеюсь, что помогает некоторым.

+542
John Gee 29 сент. 2016 г., 19:42:58

Я почти никогда не размещайте свои вопросы в интернете, но в этот раз я не мог найти решение моей проблемы. Моя проблема заключается в том, что я пытаюсь загрузиться полностью ОС Linux Mint с USB на макбук. Я уже был успешным в загрузочно-и я знаю о стойких установить. Но у меня есть флэш-накопитель 64 ГБ, и я хочу, используйте его полностью для Linux, 4 Гб не хватает. Как я могу Эфи загрузки полноценный Linux с отформатированную в FAT32 флешку, чтобы быть точным. Я думаю, что у меня приличное количество знаний о секционировании флэш-накопители и чем он отличается от жестких дисков, если это помогает. Я могу работать на Mac, Windows или Linux, так что я думаю, что решение по любой из этих было бы здорово. Любая помощь будет высоко оценили. Спасибо!

+479
Arjun Naha 26 авг. 2020 г., 13:18:16

В Debian, команда dmesg логи хранятся в виде:

  • в /var/журнал/команды dmesg (видео и несжатый)
  • в /var/журнал/команды dmesg.0 (последняя сессия и несжатый)
  • /var/log/dmesg.1.gz (предпоследний и сжатый)
  • /var/log/dmesg.2.gz (antepenultimate и сжатый)
  • /var/log/dmesg.3.gz (3-й из последних и сжатый)
  • /var/log/dmesg.4.gz (4-й из последних и сжатый)

Если у вас есть разрешение, вы можете прочитать их с кошкой, более или менее обычного и zcat выступает, zmore или zless на сжатие

+458
Nilo 1 дек. 2022 г., 08:40:52

Примечание: текущее состояние любого каноническая-при условии "Убунту сертификации" неизвестно. Пожалуйста, прочитайте ниже Вопрос/Ответ для получения дополнительной информации:

Есть такая вещь, как сертифицированный инженер Убунту?

Как этот краткий план показывает, что в Ubuntu сертифицированный профессиональный курс основан на стандартном для Linux профессиональный институт владельцев-1 аттестация.

Также известный как "младшего уровня сертификации Linux", требования к ОГП/владельцев-1 включают в себя:

  1. Установка и настройка настольной системы Ubuntu
  2. Для выполнения рутинных задач администрирования: загрузка и завершение работы системы, управление учетными записями пользователей и файловых систем, и поддержания системы безопасности
  3. Настроить подключение к сети и ключевых сетевых служб
  4. Продуктивно работать в командной строке Linux

Если вы не обладаете сертификации, который включает в себя такие навыки, то да, Убунту сертификации (или владельцев-1) может помочь вам в подаче заявления на позиции в качестве начального уровня в Ubuntu/Linux для системного администратора.

После этого, вы должны смотреть на более продвинутых владельцев-2 и владельцев-3 сертификаты уметь применять на работу за пределы "начального уровня".

+431
Amer Bani Amer 22 мая 2018 г., 06:25:40

Я использую мат 1.16.2 на Debian (стрейч) 9.0.0 и я настройке моя командная строка выбора: мат-терминал (версия 1.16.3).

Я сделала отличительной $ПС1 подскажут и персонифицировано мой .bashrc и и .bash_aliases, сделал все изменения, которые я хочу в правка > параметры профиля, даже удалось получить мате-терминал прозрачность фона сидит на работе.

Теперь я хочу, чтобы автоматически скрыть панель меню (Файл / правка / вид / поиск / и т. д.) и панель вкладок, а, возможно, даже спрятаться или еще лучше изменить цвет полосы прокрутки, когда я переключиться в полноэкранный режим (через вид > во весь экран или нажмите F11). В основном я хочу, чтобы эмулировать старинке, без полей полном экране терминала, а затем все вернется в норму, когда я возвращаюсь в оконный режим.

Возможно ли это, и если да, то как?

Я появился на этих страницах, но я не уверен, что если они будут полезны.

Есть ли способ, чтобы постоянно отключить меню в консоли на GNOME 3?

Можно ли полностью скрыть панель приложения в Xfce?

https://docs.xfce.org/xfce/xfce4-panel/theming

+380
aristos 6 авг. 2022 г., 16:06:31

Это вы так усложняете.

Сначала исправить свои пакеты

суда apt-получить -Ф установите

Пусть он делать это дело.

Далее в Ubuntu 12.10 беспроводной "просто работает", но вы, вероятно, нужно установить проприетарный драйвер.

Сидеть рядом с роутером и подключить по старинке. Затем выполните команду sudo apt-получить обновление.

Когда жокей-кде готовой запустить '' возможно, вам придется установить его. Затем просто активировать беспроводной драйвер из списка.

Что должно быть и все. жокей будет заботиться об остальном. Это должно было выскочил, когда кулак начал компьютер, но я не вижу простой способ, чтобы запустить его, если вы пропустили предупреждение. Просто запустите его из терминала вместо.

Примечание стороны, вы можете захотеть подключить и запустить apt-получить обновление до apt-получить -Ф установить, но это зависит от вас. Если ваша 12.10 вам не нужно любой водитель перенесено беспроводную сетевую карту в 8.2 с хорошо работала с 11.что-то вперед.

+376
KarateSnowMachine 16 июн. 2012 г., 07:32:42

К сожалению, это давно известная проблема с X по этой странице: http://forum.kde.org/viewtopic.php?f=66&t=102303

Я искал решение подобной проблемы, когда я наткнулся на эту страницу.

+317
A Ant 25 апр. 2017 г., 22:51:24

ВФС Глоубал в Индии, судя по всему, не возражает обязательного сертификата:

Сертификат об отсутствии возражений является обязательным для следующих категорий

  • Дети в возрасте до 18 лет должен получить его от обоих родителей.

  • В случае одного родителя, выезжающего вместе с ребенком, НОК от второго родителя является обязательным.

  • Сотрудник, работающий в организации, должен иметь НОК или оставить санкция детали от соответствующих департаментов /управлений

Источник-компания "ВФС Глоубал" ответы на заявку в Нидерландах, но они применяют его для всех шенгенских и приложений Великобритании, насколько мне известно, и, вероятно, повсеместно

http://www.vfsglobal.com/netherlands/india/faqs.html

ОП конкретно спросил про Францию, однако для справки см. также является справка об отсутствии возражений действительно необходимы при подаче заявления на британскую визу?

+312
Sulav rijal 9 июл. 2016 г., 15:52:12

Учитывая файлов fasta с последовательностью строк одинаковой длины,

файл $ кот.ФА
>СП|B7UM99|TIR_ECO27
MPIGNLGNNVNGNHLIPPAPPLPSQTDGAA
RGGTGHLISSTGALGSRSLFSPLRNSMADS
VDSRDIPGLPTNPSRLAAATSETCLLGGFE
VLHDKGPLDILNTQIGPSAFRVEVQADGTH
......
>СП|P06616|ERA_ECOLI
MSIDKSYCGFIAIVGRPNVGKSTLLNKLLG
QKISITSRKAQTTRHRIVGIHTEGAYQAIY
VDTPGLHMEEKRAINRLMNKAASSSIGDVE
LVIFVVEGTRWTPDDEMVLNKLREGKAPVI
............
>СП|P0AD68|человека
MKAAAKTQKPKRQEEHANFISWRFALLCGC
ILLALAFLLGRVAWLQVISPDMLVKEGDMR
SLRVQQVSTSRGMITDRSGRPLAVSVPVKA
IWADPKEVHDAGGISVGDRWKALANALNIP
.............

и файл запроса с именами последовательности,

запрос $ кот 
СП|B7UM99|TIR_ECO27
СП|P06616|ERA_ECOLI

затем samtools может быть использован в качестве

$ samtools faidx файл.запрос Альфа-Р 
>СП|B7UM99|TIR_ECO27
MPIGNLGNNVNGNHLIPPAPPLPSQTDGAARGGTGHLISSTGALGSRSLFSPLRNSMADS
VDSRDIPGLPTNPSRLAAATSETCLLGGFEVLHDKGPLDILNTQIGPSAFRVEVQADGTH
......
>СП|P06616|ERA_ECOLI
MSIDKSYCGFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGIHTEGAYQAIY
VDTPGLHMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWTPDDEMVLNKLREGKAPVI
............
+300
nflgamestoday 1 мар. 2020 г., 14:43:50

Фронтальный присед не должны утомлять руки. В баре поддерживается на ваши плечи, кончиками пальцев лишь удерживая его на месте--нет необходимости держать планку. Без стойки для приседаний, вам потребуется сила чистой штангу в положение, которое займет некоторое практике.

Кроме того, имейте в виду, что приседания-это не только тренировка ноги. На самом деле они не упражнения ног, период. Они работают на ногах, бедрах, и обратно в почти равной степени, и для большинства людей ноги не первая часть провалится. Присед полезен далеко не только нагружают мышцы ног.

+203
fast tooth 16 янв. 2023 г., 05:34:18

Вы имеете в виду, что маршрутизируемый IP-вашему DSL/кабельный модем/и т. д. маршрутизатор есть?

Вам нужно либо запрос, что устройство или задать внешний сервер, какой IP он видит, когда вы подключите его. Самый простой способ это сделать-искать в Google "что такое мой IP" и как расчет поисков, это вам скажут в первый результат поиска. Если вы хотите сделать это из командной строки, вы должны проверить на выходе какой-то скрипт там, что будет выводить информацию. Динамические dyndns.org DNS-сервер, что можно использовать - попробуйте эту команду

с wget http://checkip.dyndns.org -о -

Вы должны сделать что-то вроде

Запрос HTTP послан, ожидание ответа... 200 ОК
Длина: 105 [текст/HTML]
Сохранение: ‘стандартный вывод’

- 0%[ ] 0 --.-КБ/с <HTML>и<голова><название>проверить текущий IP</заголовок></голова><тело>текущий IP-адрес: 192.168.1.199</тело></HTML>и
- 100%[===================>] 105 --.-КБ/С в 0С 

2017-09-20 14:16:00 (15.4 МБ/с) - написано в stdout [105/105]

Я изменил IP в шахте универсальный немаршрутизируемый и жирным шрифтом для вас.

Если вы хотите просто ИС, вам потребуется разобрать его оттуда - быстро и грязно, но это работает для меня. И я на 100% уверен, что есть более безопасный способ сделать это...

с wget http://checkip.dyndns.org -о - | грэп ИС | вырезать -Ф 2- -Д : | вырезать -Ф 1 -Д \<

Который даст вам просто

192.168.1.199

+178
Pete Nwl 8 апр. 2021 г., 08:38:22

У меня есть некоторые проблемы удаления строки между первым пространством и на первой вкладке в текстовый файл (вкладка должна быть сохранена):

образец ввода:

col1_frame1 неважная б

ожидаемые результаты для образца:

col1_frame а б

Я попытался с помощью sed 'ы/ .*\т/\т/' но я получил неправильный вывод:

мой вывод для выборки (используя предыдущие СЭД):

col1_frame с
+147
axor 1 нояб. 2012 г., 15:54:12

Фактическое обновление само не опорожнит вашу гарантированность.

Однако, если в какой-либо части во время процесса, ваш Mac мини-перерывы, это не будет покрываться гарантией. Если вы можете успешно обновить его самостоятельно, и она прекрасно работает, то вы не должны иметь никакого беспокойства.

"Окончательный ответ будет определено в гарантии. Если вы повредите компьютер делает любое несанкционированное обслуживание, то, что ущерб не покрываются гарантией. Техники сервис Apple будет предположить, что если они найти другой жесткий диск, чем тот, который пришел с компьютером, тогда они не будут ремонтировать по гарантии, даже если ваши услуги не относящиеся к необходимости замены диска".

Вы можете избежать этой проблемы. В случае если что-то пойдет не так, вы должны переустановить старый диск, прежде чем брать компьютер в сервисный центр и оставлять никаких доказательств вы открыли компьютер. (Вы не должны делать это, если вы не чувствуете себя комфортно "мошенничество").

Ссылки и ресурсы

https://discussions.apple.com/thread/2526639?start=0&tstart=0

+147
Baraz 5 июл. 2018 г., 14:23:56

Вам нужна виза для Румынии, как Алжир имеет собственный список для список государств, чьи граждане (приложение 1) держатели простого паспорта, не требуется виза при въезде на территорию Румынии.

Вам не нужна виза для посещения Боснии, если вы остаетесь менее чем за 90 дней:

Državljani Rumunije izuzeti Су ОД viznog režima prilikom ulaska, izlaska или prelaska Преко teritorije Босне я Hercegovine сделать 90 дана периоду mjeseci у šest ОД, ОД počevši дана prvog ulaska.

(С визового сайта)

При переводе:

Граждане Румынии, освобождаются от визового режима при входе, выходе или через территорию Боснии и Герцеговины на срок до 90 дней, сроком на шесть месяцев, начиная с даты первого въезда.

Вам также потребуется виза для Черногории, вы можете получить его из сербского консульства. Информация о консульство доступен здесь.

+122
QUICK TO GENERATE 26 дек. 2012 г., 17:51:49

Показать вопросы с тегом